PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538690.1_FGP120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 424aa    MW: 45556.4 Da    PI: 7.7337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538690.1_FGP120genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-1793139148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
  KN538690.1_FGP120  93 KGAWTRQEDEVLKQMVILHGDRKWATIAKSLP-GRIGKQCRERWTNHL 139
                        79******************************.************996 PP

2Myb_DNA-binding55.21.6e-17145187145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
  KN538690.1_FGP120 145 KDVWTEEDDRMLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 187
                        578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.46888143IPR017930Myb domain
SuperFamilySSF466898.61E-2990186IPR009057Homeodomain-like
SMARTSM007177.4E-1592141IPR001005SANT/Myb domain
PfamPF002492.2E-1593139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2494146IPR009057Homeodomain-like
CDDcd001671.32E-1495139No hitNo description
SMARTSM007174.8E-18144192IPR001005SANT/Myb domain
PROSITE profilePS5129418.376144194IPR017930Myb domain
PfamPF002493.7E-15145187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-20147191IPR009057Homeodomain-like
CDDcd001677.68E-15148190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MMGSGMPHMY FASSSHGTGA HYQSPGGAPI TMAVPDMGFL VAGIGMAPSS FVMPEGALAA  60
SYSAMATVPV GVVVPQQQPS RFGGNNGNPG SFKGAWTRQE DEVLKQMVIL HGDRKWATIA  120
KSLPGRIGKQ CRERWTNHLR LDIKKDVWTE EDDRMLIEAH KTYGNRWSVI ARCLPGRSEN  180
AVKNHWNATK RSLKSKRRMK KKSVQVVNSP PGQLSPLEEY IRSQYPSAVE TAPPPPAVPA  240
PPSDVIVHGA GSVSAGPTVA TQEPTGTNPS EMGIYLGLGN PAGPTTQQLA AMNLNMSLAP  300
DLNAYNDQRE GYYLPFVPQG NLHYGMHVPA PPVQQQQQGI SVDQGLHSSC LSLYHPFPGT  360
HPVNLDFGCQ SSNHANAGGY YSEAGPSSGS GSGDPDDVDV IQMASRQFLM PSEAEVTLDL  420
TRFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41871951110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879950.0AK287995.1 Oryza sativa Japonica Group cDNA, clone: J075101C16, full insert sequence.
GenBankFJ9402150.0FJ940215.1 Oryza sativa Japonica Group clone KCS005D12 Myb protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0E0N5540.0A0A0E0N554_ORYRU; Uncharacterized protein
STRINGBGIOSGA004824-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-42myb domain protein 118